PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_097470_gokc.t1
Common NameSOVF_097470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family GATA
Protein Properties Length: 546aa    MW: 60987.1 Da    PI: 6.8152
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_097470_gokc.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.94.4e-16741135
               GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                       C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Sp_097470_gokc.t1  7 CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGT 41
                       ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.1E-10153IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.42E-11545No hitNo description
CDDcd002025.35E-16651No hitNo description
Gene3DG3DSA:3.30.50.102.3E-12741IPR013088Zinc finger, NHR/GATA-type
PfamPF003207.1E-14741IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PfamPF139191.5E-9287373IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPVLCN ACGSRWRTKG TLANYTPLHS RVDPDDYEDH  60
RVARVKTISL KKRDDKLSKR KFSYENSIEN GGYAPDYSHG FQKNHEEDTS NRSSSGSAIS  120
NSESCAQFGS ADASELSGPA QSIVWDALVP SRKRTCVTRA KQSSVEKLTK DLYTILHEQA  180
SHFSVSSEED LLYESEAPMV SVEIGHGSVL IRHPSSFVRE EESEASSLSV DNKLCRTDDR  240
YSNPASMLLL NDSKSVGSSC FGVEKVKRLN GQIMQLDQTK REKCDPESMQ ILWNHDSPLC  300
HIDLNEIVNS DVFCGHLTDE EQQKLLKYLP TMDSSTLSDS LGSILTSKQF KENLSSFQQL  360
LADGVFDTSF PGVQTEDCKV LRRLALSNMT KSKWVEYHNM LKDKRIKEST GESVRISEVK  420
SSFSGNLFNA KRSRVNQCHR WPETKTATKP PKRVVLKVDS KNKQPLQYEG SCFTPPPRNL  480
FSLPTNGSSL MLDSYQFEDE SSDQDLLLDV PSNGSFPQAE AEFFCPASSQ QASASSSSIH  540
LSHFRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010677131.10.0PREDICTED: GATA transcription factor 26
SwissprotQ8W4H11e-137GAT26_ARATH; GATA transcription factor 26
TrEMBLA0A0K9R9670.0A0A0K9R967_SPIOL; Uncharacterized protein
STRINGPOPTR_0003s08080.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-132GATA transcription factor 26